CEACAM6/CD66c Antibody - BSA Free

Western Blot: CEACAM-6/CD66c Antibody [NBP1-55290] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25ug/mL, Peptide Concentration: 1.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

Western Blot: CEACAM-6/CD66c Antibody [NBP1-55290] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25ug/mL, Peptide Concentration: 1.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

Immunohistochemistry-Paraffin: CEACAM-6/CD66c Antibody [NBP1-55290] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Western Blot: CEACAM-6/CD66c Antibody [NBP1-55290] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

CEACAM6/CD66c Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human CEACAM6 (NP_002474). Peptide sequence: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEACAM6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for CEACAM6/CD66c Antibody - BSA Free

• carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific crossreacting antigen)
• carcinoembryonic antigen-related cell adhesion molecule 6
• CD66c antigen
• CD66c
• CEACAM6
• CEACAM-6
• CEAL
• NCA
• NCACEAL
• Non-specific crossreacting antigen
• Normal cross-reacting antigen

Background

Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEACAM6
• Entrez:
  • 4680(Human)
• Uniprot:
  • P40199()