Claudin-8 Antibody - BSA Free

Western Blot: Claudin-8 Antibody [NBP1-59157] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: Claudin-8 Antibody [NBP1-59157] - Human Intestine

Western Blot: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - HepG2 cell lysate, Antibody Titration: 0.5-1.0ug/ml

Immunohistochemistry-Paraffin: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu, Po
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Claudin-8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CLDN8 (claudin 8) The peptide sequence was selected from the C terminal of CLDN8. Peptide sequence IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Reactivity Notes

Use in Porcine reported in scientific literature (PMID: 35336858).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Claudin-8 Antibody - BSA Free

• claudin 8
• Claudin8
• Claudin-8
• CLDN8
• human CLDN8 gene for claudin-810claudin-8

Background

CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Claudin-8 Antibody (NBP1-59157)(4)

Publications using NBP1-59157

• Weifeng Sun, Weixin Wu, Xinyu Fang, Xinna Ge, Yongning Zhang, Jun Han, Xin Guo, Lei Zhou, Hanchun Yang Disruption of pulmonary microvascular endothelial barrier by dysregulated claudin-8 and claudin-4: uncovered mechanisms in porcine reproductive and respiratory syndrome virus infection Cellular and Molecular Life Sciences: CMLS 2024-05-28 [PMID: 38806818]
• Sun Z, Chen X, Liu J et al. PRRSV-induced inflammation in pulmonary intravascular macrophages (PIMs) and pulmonary alveolar macrophages (PAMs) contributes to endothelial barrier function injury Veterinary microbiology 2023-04-04 [PMID: 37068404]
• Sun W, Wu W, Jiang N et al. Highly Pathogenic PRRSV-Infected Alveolar Macrophages Impair the Function of Pulmonary Microvascular Endothelial Cells Viruses 2022-03-26 [PMID: 35336858]
• Wu RL, Vazquez-Roque MI, Carlson P et al. Gluten-induced symptoms in diarrhea-predominant irritable bowel syndrome are associated with increased myosin light chain kinase activity and claudin-15 expression. Lab. Invest. 2016-11-21 [PMID: 27869798]

Bioinformatics

• Gene Symbol: CLDN8
• Uniprot:
  • P56748()