Claudin-9 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Claudin-9 Antibody [NBP2-57269] - Staining of human cell line MCF7 shows localization to cell junctions & vesicles. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Claudin-9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('GLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV',)
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Claudin-9 Recombinant Protein Antigen (NBP2-57269PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Claudin-9 Antibody - BSA Free

• claudin 9
• Claudin9
• Claudin-9
• CLDN9

Background

Claudin 9 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLDN9