CXCL8/IL-8 Antibody - BSA Free

Western Blot: CXCL8/IL-8 Antibody [NBP2-33819] - Analysis in human cell line EFO-21.

Immunocytochemistry/Immunofluorescence: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human rectum shows moderate positivity in plasma.

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human lymph node shows weak to moderate cytoplasmic positivity in a subset of non-germinal center cells.

Immunohistochemistry-Paraffin: CXCL8/IL-8 Antibody [NBP2-33819] - Staining of human placenta shows moderate positivity in plasma.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CXCL8/IL-8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CXCL8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CXCL8/IL-8 Protein (NBP2-33819PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CXCL8/IL-8 Antibody - BSA Free

• 3-10C
• AMCF-I
• C-X-C motif chemokine 8
• CXCL8
• CXCL8SCYB8
• Emoctakin
• GCP1
• GCP-1TSG-1
• IL8
• IL-8
• interleukin 8
• K60
• LAI
• LECT
• LUCT
• LYNAP
• MDNCF
• MDNCFb-ENAP
• member 8
• MONAP
• MONAPGCP1
• NAF
• NAP1
• NAP-1NAP1
• NCF
• Neutrophil-activating protein 1
• Protein 3-10C
• T cell chemotactic factor
• T-cell chemotactic factor
• TCF
• TSG1

Background

IL8 is a member of the CXC chemokine family. This family of small basic heparan-binding proteins are proinflammatory and primarily mediate the activation and migration of neutrophils into tissue from peripheral blood. This chemokine is one of the major mediators of the inflammatory response and is secreted by several cell types in response to an inflammatory stimulus. It functions as a chemoattractant, and is also a potent angiogenic factor. IL8 attracts neutrophils, basophils, and T-cells, but not monocytes. Cystic fibrosis (CF) is characterized by severe lung inflammation. The inflammatory process is believed to be caused by massive overproduction of the proinflammatory protein IL8, and the high levels of IL8 in the CF lung are therefore believed to be the central mechanism behind CF lung pathophysiology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CXCL8/IL-8 Antibody (NBP2-33819)(5)

Publications using NBP2-33819

• Lee SM, Kim SH, Kim Z et Al. Photodynamic Effects of Topical Photosensitizer, Photodithazine Using Micro-LED for Acne Bacteria Induced Inflammation Ann Dermatol 2024-12-01 [PMID: 39623608]
• Li L, Yao W, Yan S Et al. Pan-Cancer Analysis of Prognostic and Immune Infiltrates for CXCs Cancers 2021-08-18 [PMID: 34439306] (IHC-P, Human)
• C Owen-Woods, R Joulia, A Barkaway, L Rolas, B Ma, AF Nottebaum, KP Arkill, M Stein, T Girbl, M Golding, DO Bates, D Vestweber, MB Voisin, S Nourshargh Local microvascular leakage promotes trafficking of activated neutrophils to remote organs J. Clin. Invest., 2020-05-01;0(0):. 2020-05-01 [PMID: 31971917] (IHC, Human)
• Fronczek J, Lulf R, Korkmaz Hi, Witte Bi. Analysis of inflammatory cells and mediators in skin wound biopsies to determine wound age in living subjects in forensic medicine Forensic Science International et al. 2014-11-22 [PMID: 25506669] (IHC-P, Human)
  
  Details:
  CXCL8/IL-8 antibody used at 1:100 dilution in IHC-P application on human tissues from skin wounds in living subjects in forensic medicine - 4% formaldehyde solution fixation, 4um paraffin sections, endogenous peroxidases blocking with methanol/H2O2 (0.3%) for 30 min, antigen retrieval via boiling of slides for 10 min in Tris-EDTA pH 9, primary incubation for 1 h at room temperature, detection with rabbit Envision - DAB (Fig. 1e and 1f)
• Yu S, Chung S, Ha H et al. Nanotheranostics of Pre Stenotic Vessels By Target Touch On Signaling of Peptide Navigator Advanced Functional Materials 2021-12-08 (WB)

Bioinformatics

• Gene Symbol: CXCL8
• Uniprot:
  • P10145()