Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Western blot analysis of extracts of various cell lines, using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunofluorescence analysis of U-2 OS cells using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb (NBP3-16595) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human colon carcinoma tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded rat spleen tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human liver tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human kidney tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human esophagus tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded mouse kidney tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) [NBP3-16595] - Immunohistochemistry analysis of Dihydrolipoamide Dehydrogenase/DLD in paraffin-embedded human tonsil tissue using Dihydrolipoamide Dehydrogenase/DLD Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 3J2O9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 401-500 of human Dihydrolipoamide Dehydrogenase/DLD (P09622). WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DLD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dihydrolipoamide Dehydrogenase/DLD Antibody (3J2O9)

• 2-oxo-glutarate complex, branched chain keto acid dehydrogenase complex)
• branched chain keto acid dehydrogenase complex
• Diaphorase
• dihydrolipoamide dehydrogenase (E3 component of pyruvate dehydrogenase complex
• Dihydrolipoamide Dehydrogenase
• dihydrolipoamide dehydrogenasemitochondrial
• DLD
• DLDD
• DLDH
• E3 component of pyruvate dehydrogenase complex, 2-oxo-glutarate complex
• E3
• EC 1.8.1
• EC 1.8.1.4
• GCSL
• Glycine cleavage system L protein
• glycine cleavage system protein L
• LAD
• Lipoamide Dehydrogenase
• lipoamide reductase
• lipoyl dehydrogenase
• PHE3

Background

Lipoamide Dehydrogenase encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLD