DNA Primase large subunit Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DNA Primase large subunit Antibody [NBP2-58498] - Staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNA Primase large subunit Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRR
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRIM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNA Primase large subunit Recombinant Protein Antigen (NBP2-58498PEP)

Reactivity Notes

Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNA Primase large subunit Antibody - BSA Free

• dJ422B11.1.1
• DNA primase 58 kDa subunit
• DNA primase subunit p58
• EC 2.7.7
• EC 2.7.7.-
• MGC75142
• p58
• polypeptide 2A, p58
• PRIM2ADNA primase large subunit
• primase polypeptide 2A, 58kDa
• primase, DNA, polypeptide 2 (58kDa)
• primase, polypeptide 2A (58kD)
• primase, polypeptide 2A, 58kDa

Background

The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. The protein encoded by this gene is the large, 58 kDa primase subunit. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRIM2