Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: Dynein light chain 2a cytoplasmic Antibody [NBP2-92214] - Human thyroid cancer using DYNLRB1 Rabbit pAb at dilution of 1:100 (40x lens).

Western Blot: Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free [NBP2-92214] - Western blot analysis of various lysates using Dynein light chain 2a cytoplasmic Rabbit pAb at 1:700 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1). MDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DYNLRB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Dynein light chain 2a cytoplasmic Antibody - Azide and BSA Free

• BITH
• Bithoraxoid-like protein
• DNCL2Acytoplasmic dynein light chain 2A
• DNLC2ABLP
• Dynein light chain 2A, cytoplasmic
• dynein light chain roadblock-type 1
• dynein, cytoplasmic, light polypeptide 2A
• dynein, light chain, roadblock-type 1
• dynein-associated protein HKM23
• Dynein-associated protein Km23
• roadblock domain containing 1
• Roadblock domain-containing protein 1
• ROBL/LC7-like 1
• ROBLD1Roadblock-1

Background

The Dynein light chain gene is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable ofbinding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas,suggesting that this gen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DYNLRB1