ESAM Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ESAM Antibody [NBP2-56089] - Staining of human cell line U-2 OS shows localization to microtubules.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ESAM Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ESAM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ESAM Recombinant Protein Antigen (NBP2-56089PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ESAM Antibody - BSA Free

• 2310008D05Rik
• endothelial cell adhesion molecule
• endothelial cell-selective adhesion molecule
• ESAM
• HUEL (C4orf1)-interacting protein
• LP4791 protein
• W117m

Background

ESAM is a tight junction regulatory protein involved in cell adhesion and is expressed only on endothelial cells and activated platelets. It may mediate aggregation through a homophilic molecular interaction (By similarity). ESAM at endothelial tight junctions participates in the migration of neutrophils through the vessel walls and it may have a role in signaling mechanisms that trigger the opening of endothelial cell contacts. A correlation has been found between ESAM expression and lymph node metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ESAM