Glutaminase Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining in human kidney and skeletal muscle tissues using NBP1-89766 antibody. Corresponding GLS RNA-seq data are ...read more
Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male and female rats. GLT protein was measured by ...read more
Immunocytochemistry/ Immunofluorescence: Glutaminase Antibody [NBP1-89766] - Staining of human cell line SiHa shows localization to mitochondria. Antibody staining is shown in green.
Western Blot: Glutaminase Antibody [NBP1-89766] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Glutaminase Antibody [NBP1-89766] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based patterns of glycogen phosphorylase-muscle type (GPmm) Protein expression in icv Lz-pretreated male & female rats. GPmm protein was measured by Western blot ...read more
Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by ...read more
Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by ...read more
Western Blot: Glutaminase Antibody [NBP1-89766] - Region-based expression of the pyruvate recycling pathway marker protein glutaminase (GLT) the VMN of icv Lz-pretreated male & female rats. GLT protein was measured by ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

Glutaminase Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glutaminase Protein (NBP1-89766PEP)
Publications
Read Publications using
NBP1-89766 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25798620). Rat reactivity reported in scientific literature (PMID: 31265816).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glutaminase Antibody - BSA Free

  • AAD20
  • EC 3.5.1.2
  • GLS
  • GLS1DKFZp686O15119
  • glutaminase C
  • glutaminase kidney isoform, mitochondrial
  • Glutaminase
  • glutaminase, phosphate-activated
  • K-Glutaminase
  • KIAA0838FLJ10358
  • L-Glutamine Amidohydrolase

Background

Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00008833-M01
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, S-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-02615
Species: Hu, Pm, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16679
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00030851-M01
Species: Hu
Applications: ELISA, S-ELISA, Simple Western, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Glutaminase Antibody (NBP1-89766)(5)

We have publications tested in 2 confirmed species: Mouse, Rat.

We have publications tested in 3 applications: IF/IHC, Immunohistochemistry, WB.


Filter By Application
IF/IHC
(1)
Immunohistochemistry
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(2)
Rat
(2)
All Species
Showing Publications 1 - 5 of 5.
Publications using NBP1-89766 Applications Species
Emmanuel Benichou, Bolaji Seffou, Selin Topçu, Ophélie Renoult, Véronique Lenoir, Julien Planchais, Caroline Bonner, Catherine Postic, Carina Prip-Buus, Claire Pecqueur, Sandra Guilmeau, Marie-Clotilde Alves-Guerra, Renaud Dentin The transcription factor ChREBP Orchestrates liver carcinogenesis by coordinating the PI3K/AKT signaling and cancer metabolism Nature Communications 2024-02-29 [PMID: 38424041]
Briski KP, Napit PR, Alhamyani A et al. Sex-Dimorphic Octadecaneuropeptide (ODN) Regulation of Ventromedial Hypothalamic Nucleus Glucoregulatory Neuron Function and Counterregulatory Hormone Secretion ASN neuro 2023-05-17 [PMID: 37194319] (WB, Rat) WB Rat
Uddin MM, Ibrahim MMH, Briski KP Sex-dimorphic neuroestradiol regulation of ventromedial hypothalamic nucleus glucoregulatory transmitter and glycogen metabolism enzyme protein expression in the rat BMC Neurosci 2020-11-25 [PMID: 33238883] (Immunohistochemistry, Mouse) Immunohistochemistry Mouse
Uddin MM, Mahmood ASMH, Ibrahim MMH, Briski KP Sex-Dimorphic Estrogen Receptor Regulation of Ventromedial Hypothalamic Nucleus Glucoregulatory Neuron Adrenergic Receptor Expression in Hypoglycemic Male and Female Rats Brain Res. 2019-06-29 [PMID: 31265816] (WB, Rat) WB Rat
Tanaka K, Sasayama T, Irino Y et al. Compensatory glutamine metabolism promotes glioblastoma resistance to mTOR inhibitor treatment. J Clin Invest 2015-04-01 [PMID: 25798620] (IF/IHC, Mouse) IF/IHC Mouse

Reviews for Glutaminase Antibody (NBP1-89766) (0)

There are no reviews for Glutaminase Antibody (NBP1-89766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutaminase Antibody (NBP1-89766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutaminase Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GLS