HspA6 Antibody - BSA Free

Immunohistochemistry: HspA6 Antibody [NBP3-38454] - Immunohistochemistry analysis of paraffin-embedded Human liver using HspA6 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: HspA6 Antibody [NBP3-38454] - Western blot analysis of various lysates using HspA6 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HspA6 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 474-643 of human HspA6 (NP_002146.2).
  
  Sequence:
  PQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSPA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 71 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HspA6 Antibody - BSA Free

• heat shock 70 kDa protein 6
• Heat shock 70 kDa protein B'
• heat shock 70kD protein 6 (HSP70B')
• heat shock 70kDa protein 6 (HSP70B')
• HSP70B'

Background

HSP70B is a unique member of the human Hsp70 chaperone involved in cellular processes such as protein trafficking, folding, and prevention of aggregation. This protein is strictly stress-inducible, having little or no basal expression levels in most cells. HSP70B and Hsp72 are closely related and play cooperative roles in cell survival of proteotoxic stress. Recombinant human HSP70B, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSPA6