Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human kidney shows moderate positivity in cells in tubules.

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining in human prostate and skeletal muscle tissues.. Corresponding IDH1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human prostate shows strong positivity in glandular cells.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP1-87428] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IDH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22125622)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

• Cytosolic NADP-isocitrate dehydrogenase
• EC 1.1.1.42
• IDCD
• IDH
• IDH1
• IDP
• IDPC
• isocitrate dehydrogenase [NADP] cytoplasmic
• isocitrate dehydrogenase 1 (NADP+), soluble
• Isocitrate Dehydrogenase 1
• NADP(+)-specific ICDH
• NADP-dependent isocitrate dehydrogenase, cytosolic
• NADP-dependent isocitrate dehydrogenase, peroxisomal
• Oxalosuccinate decarboxylase
• PICD

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Isocitrate Dehydrogenase 1/IDH1 Antibody (NBP1-87428)(1)

Publication using NBP1-87428

• O'Dwyer D, Ralton LD, O'Shea A, Murray GI. The Proteomics of Colorectal Cancer: Identification of a Protein Signature Associated with Prognosis. PLoS One 2011-01-01 [PMID: 22125622]

Bioinformatics

• Gene Symbol: IDH1