MAP1B Antibody - BSA Free

Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-81261 antibody. Corresponding MAP1B RNA-seq data are presented for the same tissues.

Western Blot: MAP1B Antibody [NBP1-81261] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MAP1B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: MAP1B Antibody [NBP1-81261] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human cerebellum shows moderate to strong membranous positivity in cells in granular layer.

Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human skeletal muscle shows low positivity in myocytes as expected.

Immunohistochemistry-Paraffin: MAP1B Antibody [NBP1-81261] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAP1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST
• Marker: Neuronal Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAP1B Recombinant Protein Antigen (NBP1-81261PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAP1B Antibody - BSA Free

• DKFZp686E1099
• DKFZp686F1345
• FLJ38954
• FUTSCH
• MAP-1B
• MAP5
• microtubule-associated protein 1B

Background

The MAP1B gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The product of this gene is a precursor poly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAP1B Antibody (NBP1-81261)(2)

Publications using NBP1-81261

• Claudio Isella, Andrea Terrasi, Sara Erika Bellomo et al. Stromal contribution to the colorectal cancer transcriptome. Nature Genetics 2015-02-23 [PMID: 25706627] (IF/IHC, Human)
• Danielsson F, Wiking M, Mahdessian D et al. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. J Proteome Res 2013-01-04 [PMID: 23227862]

Bioinformatics

• Gene Symbol: MAP1B