MPST Antibody - BSA Free

Western Blot: MPST Antibody [NBP1-82617] - Analysis in human cell lines HEK293 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Immunocytochemistry/Immunofluorescence: MPST Antibody [NBP1-82617] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Simple Western: MPST Antibody [NBP1-82617] - Simple Western lane view shows a specific band for MPST in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on Liver lysate(s).

Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on RT-4 lysate(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MPST Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPST
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  MPST Protein (NBP1-82617PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23215842). Mouse reactivity reported in scientific literature (PMID: 27521839). Use in Rat reported in scientific literature (PMID:32215177).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MPST Antibody - BSA Free

• mercaptopyruvate sulfurtransferase
• MGC24539
• MSThuman liver rhodanese
• TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase

Background

MPST encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MPST Antibody (NBP1-82617)(13)

Publications using NBP1-82617

• Huang S, Chen X, Pan J et al. Hydrogen sulfide alleviates heart failure with preserved ejection fraction in mice by targeting mitochondrial abnormalities via PGC-1? Nitric oxide : biology and chemistry 2023-05-12 [PMID: 37182786]
• Wells G, Glasgow JN, Nargan K et al. Mu CT Analysis of the Human Tuberculous Lung Reveals Remarkable Heterogeneity in 3D Granuloma Morphology American journal of respiratory and critical care medicine 2021-05-20 [PMID: 34015247]
• Mellis A, Misko A, Arjune S et al. The role of glutamate oxaloacetate transaminases in sulfite biosynthesis and H2S metabolism Redox Biology 2020-01-01 [PMID: 33271457] (WB, Human)
• Qinyu-Zeng , Shuhua-He , Fengzhi-Chen et al. Administration of H2S improves erectile dysfunction by inhibiting phenotypic modulation of corpus cavernosum smooth muscle in bilateral cavernous nerve injury rats Nitric Oxide 2020-11-24 [PMID: 33246103] (WB, Rat)
• Jin Z, Zhang Q, Wondimu E et al. H2S stimulated bioenergetics in chicken erythrocytes and the underlying mechanism Am. J. Physiol. Regul. Integr. Comp. Physiol. 2020-05-20 [PMID: 32432916]
• Zhong L, Ding W, Zeng Q et Al. Sodium Tanshinone IIA Sulfonate Attenuates Erectile Dysfunction in Rats with Hyperlipidemia Oxid Med Cell Longev 2020-03-04 [PMID: 32215177] (WB, Rat)
• Md. Aejazur Rahman, Bridgette M. Cumming, Kelvin W. Addicott, Hayden T. Pacl, Shannon L. Russell, Kievershen Nargan, Threnesan Naidoo, Pratistadevi K. Ramdial, John H. Adamson, Rui Wang, Adrie J. C. Steyn Hydrogen sulfide dysregulates the immune response by suppressing central carbon metabolism to promote tuberculosis Proceedings of the National Academy of Sciences of the United States of America 2020-03-24 [PMID: 32139610]
• Li M, Xu C, Shi J et Al. Fatty acids promote fatty liver disease via the dysregulation of 3-mercaptopyruvate sulfurtransferase/hydrogen sulfide pathway Gut 2018-12-01 [PMID: 28877979]
• Yetik-Anacak G, Dikmen A, Coletta C et al. Hydrogen sulfide compensates nitric oxide deficiency in murine corpus cavernosum. Pharmacol. Res. 2016-08-10 [PMID: 27521839] (WB, Mouse)
• Rashid S, Heer JK, Garle MJ et al. Hydrogen Sulphide-induced relaxation of porcine peripheral bronchioles. Br J Pharmacol. 2012-12-06 [PMID: 23215842]
• Shibuya N, Mikami Y, Kimura Y et al. Vascular endothelium expresses 3-mercaptopyruvate sulfurtransferase and produces hydrogen sulfide. J Biochem 2009-11-01 [PMID: 19605461]
• Wells G, Glasgow J, Nargan K et al. 3D microarchitecture of the human tuberculous granuloma bioRxiv 2020-06-15 (IF/IHC, Human)
• Mitidieri E, Vanacore D, Turnaturi C et al. Uterine Dysfunction in Diabetic Mice: The Role of Hydrogen Sulfide Antioxidants (Basel, Switzerland) 2020-09-26 [PMID: 32993056] (WB, Mouse)

Bioinformatics

• Gene Symbol: MPST
• Entrez:
  • 4357(Human)
• Uniprot:
  • P25325(Human)