MST3 Antibody - BSA Free

Western Blot: MST3 Antibody [NBP1-87834] - Analysis using Anti-STK24 antibody NBP1-87834 (A) shows similar pattern to independent antibody NBP1-87833 (B).

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Western Blot: MST3 Antibody [NBP1-87834] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human colon.

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human testis.

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human liver.

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human liver, skin, small intestine and testis using Anti-STK24 antibody NBP1-87834 (A) shows similar protein distribution across tissues to independent antibody NBP1-87833 (B).

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87834] - Staining of human liver shows very weak positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MST3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK24
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MST3 Protein (NBP1-87834PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MST3 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• Mammalian STE20-like protein kinase 3
• MST-3
• MST3serine/threonine kinase 24 (Ste20, yeast homolog)
• serine/threonine kinase 24
• serine/threonine-protein kinase 24
• STE20
• STE20-like kinase 3
• STE20-like kinase MST3
• sterile 20-like kinase 3
• STK3yeast)

Background

The growth of axons is fundamental to the development and repair of brain circuitry. It has been shown that Mst3, a neuron-specific homolog of the yeast kinase Ste20, is critical for axon outgrowth. Mst3 is activated in response to trophic factors, and suppressing its expression or its function blocks axon outgrowth (1). Mst3 has been recently demonstrated to undergo a caspase-mediated cleavage during apoptosis. The proteolytic cleavage of the C-terminus of Mst3 caused nuclear translocation of its kinase domain. Mst3 contains both nuclear localization sequence (NLS) and NES signals, which may cooperate to control the subcellular distribution of Mst3 (2). In situ hybridization of rat brain sections indicated that MST3b is widely expressed in different brain regions, with especially high expression in hippocampus and cerebral cortex. When expressed in human embryonic kidney 293 (HEK293) cells, MST3b effectively phosphorylated myelin basic protein, as well as undergoing autophosphorylation (3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK24