N-WASP Antibody - BSA Free

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding WASL RNA-seq data are presented for the same tissues.

Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: N-WASP Antibody [NBP1-82512] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in human cell line RT-4.

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human kidney shows moderate to strong positivity in cells in tubules and glomeruli.

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human skeletal muscle shows weak positivity in myocytes.

Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human stomach shows moderate to strong positivity in glandular cells.

Simple Western: N-WASP Antibody [NBP1-82512] - Simple Western lane view shows a specific band for N-WASP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Western Blot: N-WASP Antibody [NBP1-82512] - Generation of nWASP knockdown cell lines. A-549 & SK-MES-1 cells were treated with nWASP siRNA/non-targeting siRNA (NT) at 0.5 μg/ml & then analysed for nWASP expression after 48 h. a QPCR analysis of nWASP transcript expression demonstrates a significant decrease in expression in siRNA treated cells, n = 4 replicates. b PCR also demonstrates a decrease in nWASP expression. c Quantitative analysis of Western blots (n = 4) shows significant decrease in nWASP protein expression in both A-549 & SK-MES1 cell lines after 48 h siRNA treatment. d Representative image showing knockdown of nWASP at protein level in siRNA treated cells at 48 h Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28351346), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: N-WASP Antibody [NBP1-82512] - nWASP activity affects A-549 & SK-MES-1 cell growth. a, b nWASP inhibition using 10 μM wiskostatin treatment significantly impairs the growth of A-549 & SK-MES-1 cells, respectively. c, d A significant effect on growth is also evident after 3 days in nWASP knockdown A-549 & SK-MES-1 cells, respectively, when compared to non-targeting control treated cells Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28351346), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

N-WASP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WASL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
• Control Peptide:

  N-WASP Protein (NBP1-82512PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for N-WASP Antibody - BSA Free

• NWASP
• N-WASP
• N-WASPneural WiskNWASP
• TRS4
• WASL
• WiskDKFZp779G0847
• WiskMGC48327

Background

The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for N-WASP Antibody (NBP1-82512)(7)

Publications using NBP1-82512

• Frugtniet BA, Ruge F, Sanders AJ et al. nWASP Inhibition Increases Wound Healing via TrKb/PLC? Signalling Biomolecules 2023-02-17 [PMID: 36830748] (ICC/IF, Human)
• Wang D, Ye Z, Wei W et al. Capping protein regulates endosomal trafficking by controlling F-actin density around endocytic vesicles and recruiting RAB5 effectors eLife 2021-11-19 [PMID: 34796874]
• Faris R, McCullough A, Andersen SE et al. The Chlamydia trachomatis secreted effector TmeA hijacks the N-WASP-ARP2/3 actin remodeling axis to facilitate cellular invasion PLoS pathogens 2020-09-01 [PMID: 32946535] (ICC/IF, Human)
• Bravo-Santano N, Stolting H, Cooper F et al. Host-directed kinase inhibitors act as novel therapies against intracellular Staphylococcus aureus Sci Rep 2019-03-19 [PMID: 30890742] (WB, Human)
• Frugtniet BA, Martin TA, Zhang L, Jiang WG. Neural Wiskott-Aldrich syndrome protein (nWASP) is implicated in human lung cancer invasion. BMC Cancer. 2017-03-28 [PMID: 28351346] (WB, Human)
• Schell C, Baumhakl L, Salou S et al. N-WASP Is Required for Stabilization of Podocyte Foot Processes. J Am Soc Nephrol 2013-04-01 [PMID: 23471198] (ICC/IF, Mouse)
• Yu X, Zech T, McDonald L et al. N-WASP coordinates the delivery and F-actin-mediated capture of MT1-MMP at invasive pseudopods. J Cell Biol 2012-10-29 [PMID: 23091069]

Bioinformatics

• Gene Symbol: WASL