OAS3 Antibody - BSA Free

Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human duodenum shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: OAS3 Antibody [NBP1-85841] - Staining of human liver shows no positivity in hepatocytes.

Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OAS3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGCSGLGHPIQLDPNQKTPENSKSLNAVYPRAGSKPPSCP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OAS3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OAS3 Protein (NBP1-85841PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OAS3 Antibody - BSA Free

• (2-5')oligo(A) synthase 3,2'-5'oligoadenylate synthetase p100
• 2-5A synthase 3
• 2'-5'-oligoadenylate synthase 3
• 2'-5'-oligoadenylate synthetase 3, 100kDa
• P/OKcl.4
• p100 OAS

Background

The OAS3 gene encodes an enzyme included in the 2', 5' oligoadenylate synthase family. This enzyme is induced by interferons and catalyzes the 2', 5' oligomers of adenosine in order to bind and activate RNase L. This enzyme family plays a significant role in

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OAS3