OMA1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: OMA1 Antibody [NBP2-30971] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: OMA1 Antibody [NBP2-30971] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human colon shows weak to moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human lymphoid tissues shows moderate granular cytoplasmic positivity in germinal center cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OMA1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OMA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OMA1 Protein (NBP2-30971PEP)

  Loading...

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OMA1 Antibody - BSA Free

• 2010001O09Rik
• DAB1
• EC 3.4.24.-
• metalloprotease related protein 1
• Metalloprotease-related protein 1
• MPRP1
• MPRP-1mitochondrial
• OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
• overlapping activity with M-AAA protease
• YKR087C
• ZMPOMA1

Background

OMA1, also known as Metalloendopeptidase OMA1, mitochondrial, has 2 isoforms, a 524 amino acid long isoform that is 60 kDa and a short 486 amino acid isoform that is 56 kDa; widely expressed, with strong expression in the heart, skeletal muscle, kidney and liver; participates in the quality control system in the inner membrane of mitochondria following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions. Studies are being performed on the relationship of this protein to amyotrophic lateral sclerosis, lateral sclerosis, childhood medulloblastoma, and medulloblastoma. OMA1 protein involvement has been observed with relation to diet induced thermogenesis, glucose metabolic process, misfolded or incompletely synthesized protein catabolic process, lipid metabolic process, negative regulation of mitochondrial fusion, and cristae formation processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OMA1 Antibody (NBP2-30971)(1)

Publication using NBP2-30971

• Consolato F, Maltecca F et al. m-AAA and i-AAA complexes coordinate to regulate OMA1, the stress-activated supervisor of mitochondrial dynamics. J Cell Sci 2018-09-04 [PMID: 29545505] (WB, Human)

Bioinformatics

• Gene Symbol: OMA1
• Uniprot:
  • Q96E52(Human)