OMgp Antibody - BSA Free

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining in human cerebral cortex and pancreas tissues using anti-OMG antibody. Corresponding OMG RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human caudate nucleus.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human kidney.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human colon.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Analysis in human cerebral cortex and liver tissues. Corresponding OMgp RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human caudate nucleus shows moderate to strong positivity in neuronal processes.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human cerebral cortex shows moderate positivity in neuropil, as well as staining in glial cells.

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human caudate nucleus, cerebral cortex, kidney and liver using Anti-OMgp antibody NBP1-82484 (A) shows similar protein distribution across tissues to independent antibody NBP1-82483 (B).

Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82484] - Staining of human kidney shows no positivity in cells in tubules as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OMgp Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVANAWKVNA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OMG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  OMgp Protein (NBP1-82484PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OMgp Antibody - BSA Free

• oligodendrocyte myelin glycoprotein
• OMG
• OMgp
• OMGPoligodendrocyte-myelin glycoprotein

Background

Myelin oligodendrocyte glycoprotein (MOG) is found on the surface of myelinating oligodendrocytes and external lamellae of myelin sheaths in the central nervous system. MOG is a minor component of the myelin sheath and is implicated in completion and maintenance of the myelin sheath and in cell-cell communication. MOG is found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes; peak expression has been observed between postnatal days 15 and 25, coincident with the period of active myelination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OMG