PARP Antibody - BSA Free

Western Blot: PARP Antibody [NBP2-13732] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western Blot: PARP Antibody [NBP2-13732] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: PARP Antibody [NBP2-13732] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human pancreas shows strong nuclear positivity.

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human parathyroid gland shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PARP Antibody [NBP2-13732] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PARP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  PARP Recombinant Protein Antigen (NBP2-13732PEP)

  Loading...

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34890590) .

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PARP Antibody - BSA Free

• ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)
• ADPRT 1
• ADPRT
• ADPRTADP-ribosyltransferase NAD(+)
• EC 2.4.2
• EC 2.4.2.30
• NAD(+) ADP-ribosyltransferase 1
• PARP apoptosis
• PARP
• PARP1
• PARP-1
• PARPADPRT1
• poly (ADP-ribose) polymerase 1
• poly (ADP-ribose) polymerase family, member 1
• poly [ADP-ribose] polymerase 1
• poly(ADP-ribose) polymerase
• poly(ADP-ribose) synthetase
• poly(ADP-ribosyl)transferase
• Poly[ADP-ribose] synthase 1
• PPOL
• PPOLpADPRT-1

Background

Poly (ADP-ribose) polymerase (PARP) is protein family primarily invloved in DNA repair and programmed cell death. PARP proteins are activated in response to DNA single strand breaks (SSBs). Upon SSB detection, PARP binds the DNA and synthesizes a PAR chain at the damaged site, which then signals the initiation of DNA repair by other enzymes such as XRCC1, DNA ligase III and DNA polymerase beta. After repair, the PAR chains are degraded via PAR glycohydrolase.

PARP is inactivated by caspase cleavage, leading to a programmed cell death pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PARP Antibody (NBP2-13732)(4)

Publications using NBP2-13732

• Kopiasz ?, Dziendzikowska K, Oczkowski M et al. Low-molar-mass oat beta-glucan impacts autophagy and apoptosis in early stages of induced colorectal carcinogenesis in rats International Journal of Biological Macromolecules 2023-11-01 [PMID: 37924897]
• Kitamura H, Tanigawa T, Kuzumoto T et al. Interferon-alpha exerts proinflammatory properties in experimental radiation-induced esophagitis: Possible involvement of plasmacytoid dendritic cells Life sciences 2022-01-15 [PMID: 34890590] (WB, Mouse)
• Sikorski K, Mehta A et al. A high-throughput pipeline for validation of antibodies. Nat Methods 2018-01-11 [PMID: 30377371] (Human)
  
  Details:
  Antibody validation based on denaturing gel electrophoresis of biotinylated cell lysates (PAGE) followed by mass spectrometry (MS) and antibody array analysis (MAP).
• Tadi SK, Tellier-Lebegue C, Nemoz C et al. PAXX Is an Accessory c-NHEJ Factor that Associates with Ku70 and Has Overlapping Functions with XLF. Cell Rep 2016-10-04 [PMID: 27705800] (WB, Human)

Review for PARP Antibody (NBP2-13732) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Ranveer Singh WB Human 07/22/2014

Summary

• Application: Western Blot
• Sample Tested: HEK293T cells whole cell lysate
• Species: Human

FAQs for PARP Antibody (NBP2-13732). (Showing 1 - 3 of 3 FAQs).

1. I was wondering if you would mind letting me know which product would you recommend for immunochemistry of the retina of the rat and mouse by poly (ADP-ribose) polymerase (PARP) and calpain. There are many different calpain antibodies in your website. The samples are 12-um vertical cryostst sections (fixed by PFA).  ..show answer..
   • For PARP, I would recommend either NB120-2168 or NB100-64828. Bear in mind that they are both mouse monoclonals, and you may have to take extra steps to reduce mouse-on-mouse background.
2. Do you have any 100 coda or bigger controls?  ..show answer..
   • I can recommend a couple of high weight antibodies that are conserved in most samples. Please verify the presence of the protein before using as a loading control. PARP1 or PARP is approximately 113kDa, and you may view the products we offer to PARP using this link. Vinculin is approximately 116kDa, and you may view the products we offer to Vinculin using this link.
3. could you please confirm how many approx tests ihc can nbp2-13732 can performed?  ..show answer..
   • For this antibody we recommend a 1:1000 - 1:2500 dilution for immunohistochemistry. If you get the 100ul unit, you will get 100ml of working solution. Usually 50ul working solution is added to the tissue. Depending on the tissue type, you can perform approximately 2000 assays.

Bioinformatics

• Gene Symbol: PARP1