Paxillin Antibody - BSA Free

Western Blot: Paxillin Antibody [NBP2-57097] - Analysis in human cell line U-87 MG.

Immunocytochemistry/Immunofluorescence: Paxillin Antibody [NBP2-57097] - Staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Paxillin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALNGTILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PXN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 1:250 - 1:500
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Paxillin Recombinant Protein Antigen (NBP2-57097PEP)

Reactivity Notes

Mouse 83%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Paxillin Antibody - BSA Free

• FLJ16691
• Paxillin
• PXN

Background

Paxillin is a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion) (1). Paxillin plays a significant role in integrin signaling and the tyrosine phosphorylation of paxillin is required for integrin-mediated cytoskeletal reorganization (2). Paxillin is phosphorylated by focal adhesion kinase (FAK) at Tyr118 (3). It has been found that phosphorylation of paxillin at both Tyr118 and Tyr31 is essential for MM1 cancer cell migration (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PXN