PGD2 Synthase/PTGDS Antibody - BSA Free

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Staining of mouse brain . Image provided by Allison Brager - Department of Neurobiology, Morehouse School of Medicine.

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PGD2 Synthase/PTGDS Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGDS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PGD2 Synthase/PTGDS Antibody - BSA Free

• Beta-trace protein
• Cerebrin-28
• EC 5.3.99.2
• Glutathione-independent PGD synthase
• glutathione-independent PGD synthetase
• lipocalin-type prostaglandin D synthase
• Lipocalin-type prostaglandin-D synthase
• L-PGDS
• PDS
• PGD2 Synthase
• PGD2
• PGDS2
• PGDSLPGDS
• PH2DISO
• prostaglandin D synthase
• prostaglandin D2 synthase (21kD, brain)
• prostaglandin D2 synthase 21kDa (brain)
• Prostaglandin-D2 synthase
• prostaglandin-H2 D-isomerase
• PTGDS

Background

Prostaglandin D Synthase (PTGDS), is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of amyloid-b plaques in Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PGD2 Synthase/PTGDS Antibody (NBP1-79280)(3)

Publications using NBP1-79280

• Rittchen S, Jandl K, Lanz I et al. Monocytes and Macrophages Serve as Potent Prostaglandin D(2) Sources during Acute, Non-Allergic Pulmonary Inflammation International Journal of Molecular Sciences 2021-10-28 [PMID: 34769126]
• Huang HL, Huang YC, Lee WY et al. 18F-Glutathione Conjugate as a PET Tracer for Imaging Tumors that Overexpress L-PGDS Enzyme PLoS ONE 2014-08-12 [PMID: 25111383]
• Lovell,MA. Neurology 70 (23), 2212-2218. 2008-01-01 [PMID: 18448869]

Review for PGD2 Synthase/PTGDS Antibody (NBP1-79280) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IHC-P Mouse 08/08/2013

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: mouse brain
• Species: Mouse
• Lot: QC18056

FAQs for PGD2 Synthase/PTGDS Antibody (NBP1-79280). (Showing 1 - 1 of 1 FAQs).

1. We have selected NBP1-79280 as the PTGDS antibody for ICH-P in our research. We noticed that IHC-P HIER pH6 retrieval is recommended for NBP1-81291, but there is no recommended retrieval method for NBP1-79280. So we want to ask that whether it is unnecessary to perform any retrieval method for NBP1-79280 in IHC-P protocol for the human brain tissues?  ..show answer..
   • If an antigen retrieval method is not mentioned on the datasheet, it may be that it is not required. (The testing of this particular antibody is carried out for us by an external company, and so unfortunately I do not have all the details of the protocols used.) However, you may choose to carry out the antigen retrieval anyway, as it will only enhance the signal. We recommend the citrate buffer (pH 6) method described in our antigen retrieval protocol.

Bioinformatics

• Gene Symbol: PTGDS
• Entrez:
  • 5730(Human)
  • 19215(Mouse)
  • 25526(Rat)
• Uniprot:
  • P41222()