RAB5C Antibody - BSA Free

Western Blot: RAB5C Antibody [NBP1-80858] - Analysis in human cell lines A-549 and PC-3 using Anti-RAB5C antibody. Corresponding RAB5C RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Western Blot: RAB5C Antibody [NBP1-80858] - Human cancer cell line lysates PC-3, LOVO and SK-BR-3. Image from verified customer review.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAB5C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
• Marker: Early Endosome Marker
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB5C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry Reported in (PMID: 24802056)
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  RAB5C Protein (NBP1-80858PEP)

Reactivity Notes

Mouse reported in ( PMID: 32096265).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAB5C Antibody - BSA Free

• L1880
• MGC117217
• RAB5C, member of RAS oncogene family
• RAB5C, member RAS oncogene family
• RAB5CL
• RAB5L
• RABLMGC138857
• ras-related protein Rab-5C

Background

Protein transport. probably involved in vesicular traffic.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB5C Antibody (NBP1-80858)(7)

Publications using NBP1-80858

• Shayeganpour K Creation of a Humanized Mouse Model to Study Islet Graft Rejection Thesis 2022-01-01 (IF/IHC, Human)
• Genard GC, Tirinato L, Pagliari F et Al. Lipid droplets and small extracellular vesicles: More than two independent entities J Extracell Biol 2024-09-01 [PMID: 39257626]
• Takahashi J, Mizutani T, Sugihara H et al. Suspension culture in a rotating bioreactor for efficient generation of human intestinal organoids Cell reports methods 2022-11-21 [PMID: 36452871] (IF/IHC, Human)
• Anand IS, Choi WY, Isberg RR Components of the endocytic and recycling trafficking pathways interfere with the integrity of the Legionella-containing vacuole Cell Microbiol 2020-02-26 [PMID: 32096265] (Western Blot, Mouse)
• Yoon S, Han E, Choi YC et al. Inhibition of Cell Proliferation and Migration by miR-509-3p That Targets CDK2, Rac1, and PIK3C2A. Mol Cells 2014-04-01 [PMID: 24802056] (IF/IHC, Human)
• Jiwani S, Wang Y, Dowd GC et al. Identification of components of the host type IA phosphoinositide 3-kinase pathway that promote internalization of Listeria monocytogenes. Infect Immun 2012-03-01 [PMID: 22158742]
• Chen PI, Kong C, Su X et al. Rab5 isoforms differentially regulate the trafficking and degradation of epidermal growth factor receptors. J Biol Chem 2009-10-01 [PMID: 19723633]

Reviews for RAB5C Antibody (NBP1-80858) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Feng Li WB Human 11/18/2019

Summary

• Application: Western Blot
• Sample Tested: AGS human gastric adenocarcinoma cell line
• Species: Human
• Lot: A104967

reviewed by: Verified Customer WB Human 07/18/2018

Summary

• Application: Western Blot
• Sample Tested: 3 human cancer cell lines
• Species: Human
• Lot: A33617

Comments

• Comments: Total cell lysates from PC-3, LOVO and SK-BR-3 were subjected to western blot. PVDF membrane were probed with 0.5 um/ml RAB5C Antibody (NBP1-80858). A specific band was detected for RAB5C at approximately 25 kDa. This experiment was conducted under reducing conditions

Bioinformatics

• Gene Symbol: RAB5C
• Entrez:
  • 5878(Human)
• Uniprot:
  • P51148(Human)