ASAP1 Antibody - BSA Free

Western Blot: ASAP1 Antibody [NBP2-48909] - Loss of ASAP1 results in expansion of the hypertrophic zone. E15.5 Asap1+/+ (Q,R) and Asap1GT/GT (S,T). ASAP1 immunostaining indicates specific expression of ASAP1 in the perichondrium, in late hypertrophic chondrocytes and in the primary ossification center. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1008216) licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: ASAP1 Antibody [NBP2-48909] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.

Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48909] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry: ASAP1 Antibody [NBP2-48909] - Loss of ASAP1 results in expansion of the hypertrophic zone.(A-D) E15.5 Asap1+/+ & Asap1GT/GT growth plates of the humerus stained for Alcian Blue / von Kossa in blue & black, respectively. The length of the hypertrophic zone (hz) is demarcated by a black bar. (E-T) Immunostaining of E15.5 Asap1+/+ & Asap1GT/GT humeral growth plates. Staining of the hypertrophic marker collagen X (E-H) & the osteogenic markers osteocalcin (I-L) & osteopontin (M-P) was detected by Nova Red & counterstained with hematoxilin. ASAP1 immunostaining indicates specific expression of ASAP1 in the perichondrium, in late hypertrophic chondrocytes & in the primary ossification center (Q-T). The scale bars shown at the bottom of the panels apply to all pictures above the given scale bar. (U) Quantification of the distal hypertrophic zones of the humerus of Asap1+/+ & Asap1GT/GT animals (Asap1+/+ n = 5, Asap1GT/GT n = 5). Graphs show the mean ± SD. Significance was calculated using the Student’s t-test. **, p <0.005. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31246957), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ASAP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockout Validated
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ASAP1 Recombinant Protein Antigen (NBP2-48909PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31246957).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ASAP1 Antibody - BSA Free

• 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein
• AMAP1
• ARF GTPase-activating protein 1
• arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
• ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
• centaurin, beta 4
• CENTB4
• DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1
• development and differentiation enhancing factor 1
• Development and differentiation-enhancing factor 1
• Differentiation-enhancing factor 1
• KIAA1249DEF-1
• PAG2
• PAP
• PIP2-dependent ARF1 GAP
• ZG14P

Background

ASAP1 (also known as AMAP1, 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein, PIP2-dependent ARF1 GAP,ADP-ribosylation factor-directed GTPase-activating protein 1, ARF GTPase-activating protein 1, Development and differentiation-enhancing factor 1, Differentiation-enhancing factor 1, DEF-1) is an Arf-directed GTPase activating protein that is a substrate for the kinases Src and FAK and has been implicated in the regulation of membrane traffic, focal adhesions and invadopodia/podosomes. Phosphorylation of ASAP1 at tyrosine 782 has been found to affect enzymatic and some biological activities, including the function of invadopodia. ASAP1 is expressed in many tissues but is most abundant in the testis, brain, lung and spleen. A heightened expression was seen in the adipose tissue from obese (ob) and diabetic (db) animals. Multiple transcript variants have been reported for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ASAP1 Antibody (NBP2-48909)(2)

Publications using NBP2-48909

• Schreiber C, Gruber A, Robwag S et al. Loss of ASAP1 in the MMTV-PyMT model of luminal breast cancer activates AKT, accelerates tumorigenesis, and promotes metastasis Cancer letters 2022-02-15 [PMID: 35181478] (IHC-P, Mouse)
• Schreiber C, Saraswati S, Harkins S et al. Loss of ASAP1 in mice impairs adipogenic and osteogenic differentiation of mesenchymal progenitor cells through dysregulation of FAK/Src and AKT signaling PLoS Genet. 2019-06-01 [PMID: 31246957] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: ASAP1