RNA Helicase A Antibody (3G7) - Azide and BSA Free

Western Blot: RNA Helicase A Antibody (3G7) [H00001660-M01] - DHX9 monoclonal antibody (M01), clone 3G7 Analysis of DHX9 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: RNA Helicase A Antibody (3G7) [H00001660-M01] - Analysis of monoclonal antibody to DHX9 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: RNA Helicase A Antibody (3G7) [H00001660-M01] - Analysis of monoclonal antibody to DHX9 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3G7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNA Helicase A Antibody (3G7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DHX9 (NP_001348, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
• Specificity: DHX9 - DEAH (Asp-Glu-Ala-His) box polypeptide 9
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DHX9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recominant protein and cell lysate for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNA Helicase A Antibody (3G7) - Azide and BSA Free

• DDX9
• DDX9ATP-dependent RNA helicase A
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin)
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9
• DEAH (Asp-Glu-Ala-His) box polypeptide 9
• DEAH box protein 9
• DExH-box helicase 9
• DHX9
• EC 3.6.1
• EC 3.6.1.15
• EC 3.6.4.13
• FLJ17406
• Leukophysin
• LKP
• NDH II
• NDH2
• NDHII
• Nuclear DNA helicase II
• RHA
• RNA Helicase A

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNA Helicase A Antibody (H00001660-M01)(7)

Publications using H00001660-M01

• Chen Zhi Xiong, Wallis Karin, Fell Stuart M et al. RNA helicase A is a downstream mediator of KIF1Bbeta tumor-suppressor function in neuroblastoma. Cancer Discov. 2014-01-27 [PMID: 24469107] (WB)
• Xing L, Niu M, Zhao X, Kleiman L. Roles of the Linker Region of RNA Helicase A in HIV-1 RNA Metabolism. PLoS One. 2013-11-06 [PMID: 24223160]
• Tsai PL, Chiou NT, Kuss S et al. Cellular RNA Binding Proteins NS1-BP and hnRNP K Regulate Influenza A Virus RNA Splicing. PLoS Pathog. 2013-06-27 [PMID: 23825951]
• Xing L, Niu M, Kleiman L. In vitro and in vivo analysis of the interaction between RNA helicase A and HIV-1 RNA. J Virol. 2012-09-26 [PMID: 23015696]
• Xing L, Liang C, Kleiman L. Coordinate roles of Gag and RNA helicase A in promoting the annealing of tRNALys3 to HIV-1 RNA. J Virol. 2010-11-24 [PMID: 21106734]
• Liu J, Song Y, Tian B et al. Functional proteomic analysis of promyelocytic leukaemia nuclear bodies in irradiation-induced MCF-7 cells. J Biochem. 2010-09-07 [PMID: 20823370]
• Robb GB, Rana TM. RNA Helicase A Interacts with RISC in Human Cells and Functions in RISC Loading. Mol Cell. 2007-05-25 [PMID: 17531811]

Bioinformatics

• Gene Symbol: DHX9
• Entrez:
  • 1660(Human)
• OMIM:
  • 603115(Human)
• Uniprot:
  • NP_001348(Human)