Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody [NBP1-52823] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR5A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID : 30529237). See Simple Western Antibody Database for Simple Western validation: Human fetal adrenal glands as sample; separated by size; antibody dilution of 1:50; observed molecular weight was ~56 kDa; matrix was 12-230 kDa; detected by Chemiluminescence.
Theoretical MW
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-52823 in the following applications:
Use in Mouse reported in scientific literature (PMID:34183774)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free
AD4BP
AD4BPSTF-1
Adrenal 4-binding protein
ELP
FTZ1adrenal 4 binding protein
FTZF1
FTZF1nuclear receptor AdBP4
Fushi tarazu factor homolog 1
NR5A1
Nuclear receptor subfamily 5 group A member 1
nuclear receptor subfamily 5, group A, member 1
SF1
SF-1
SF-1POF7
SF1steroidogenic factor 1
Steroid hormone receptor Ad4BP
steroidogenic factor-1
Background
NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823) (0)
There are no reviews for SF-1/NR5A1/Steroidogenic Factor 1 Antibody (NBP1-52823).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free and receive a gift card or discount.