Smad2/3 Antibody - BSA Free

Western Blot: Smad2/3 Antibody [NBP3-15589] - Western blot analysis of extracts of various cell lines, using Smad2/3 antibody (NBP3-15589) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Immunocytochemistry/ Immunofluorescence: Smad2/3 Antibody - Azide and BSA Free [Smad2/3] - Immunofluorescence analysis of Hep G2 cells using Smad2/3 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Smad2/3 Antibody - Azide and BSA Free [Smad2/3] - Immunohistochemistry analysis of paraffin-embedded Rat intestine tissue using Smad2/3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry: Smad2/3 Antibody - Azide and BSA Free [Smad2/3] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Smad2/3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry: Smad2/3 Antibody - Azide and BSA Free [Smad2/3] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Smad2/3 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Smad2/3 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-270 of human Smad2/3 (NP_005893.1). EYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMAD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 -1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Smad2/3 Antibody - BSA Free

• hMAD-2
• hSMAD2
• JV18
• JV18-1SMAD, mothers against DPP homolog 2 (Drosophila)
• MAD homolog 2
• Mad protein homolog
• Mad, mothers against decapentaplegic homolog 2
• MADH2MGC34440
• MADR2MGC22139
• Mad-related protein 2
• mother against DPP homolog 2
• mothers against decapentaplegic homolog 2
• Mothers against DPP homolog 2
• Sma- and Mad-related protein 2
• SMAD 2
• SMAD family member 2MAD, mothers against decapentaplegic homolog 2 (Drosophila)
• SMAD, mothers against DPP homolog 2
• Smad2
• Smad2/3

Background

Smad proteins are essential mediators of signal transduction by the TGF-beta superfamily from the cell surface into the nucleus. Once in the nucleus, Smad proteins target a number of DNA binding proteins to stimulate transcription. Smad4, also known as the common-mediator Smad (co-Smad), interacts with the receptor-regulated Smad proteins (R-SMAD). The R-SMAD class includes Smad2 and Smad3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SMAD2