stonin-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: stonin-2 Antibody [NBP1-90658] - Analysis in human cerebral cortex and liver tissues using NBP1-90658 antibody. Corresponding STON2 RNA-seq data are presented for the same tissues.

Western Blot: stonin-2 Antibody [NBP1-90658] - Analysis in human cell line K562.

Immunocytochemistry/Immunofluorescence: stonin-2 Antibody [NBP1-90658] - Staining of human cell line A-431 shows positivity in nucleoli & cytoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: stonin-2 Antibody [NBP1-90658] - Staining of human duodenum shows moderate positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: stonin-2 Antibody [NBP1-90658] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: stonin-2 Antibody [NBP1-90658] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: stonin-2 Antibody [NBP1-90658] - Staining of human liver shows no positivity in hepatocytes as expected.

Simple Western: stonin-2 Antibody [NBP1-90658] - Simple Western lane view shows a specific band for stonin-2 in 0.2 mg/ml of HEL lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: stonin-2 Antibody [NBP1-90658] - Electropherogram image of the corresponding Simple Western lane view. stonin-2 antibody was used at 1:5 dilution on HEL lysate(s) respectively.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

stonin-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RTPSVTEAPPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISSTTGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSARSQPRDGWPMMLRIPEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STON2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:5
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in HEL lysates, separated by Size, antibody dilution of 1:5
• Control Peptide:

  stonin-2 Protein (NBP1-90658PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for stonin-2 Antibody - BSA Free

• STN2
• STNB
• STNB2
• stoned B homolog 2
• stonin 2
• stonin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for stonin-2 Antibody (NBP1-90658)(1)

Publication using NBP1-90658

• Hosoda Y, Miyake M, Meguro A et al. Keratoconus-susceptibility gene identification by corneal thickness genome-wide association study and artificial intelligence IBM Watson Commun Biol 2020-07-31 [PMID: 32737415] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: STON2