![Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining in human testis and pancreas tissues using anti-SAE1 antibody. Corresponding SAE1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SUMO-Activating-Enzyme-E1-SAE1-Antibody-Immunohistochemistry-Paraffin-NBP2-13273-img0008.jpg "Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining in human testis and pancreas tissues using anti-SAE1 antibody. Corresponding SAE1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SAE1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUMO Activating Enzyme E1 (SAE1) Antibody (NBP2-13273)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SAE1 |
![Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Analysis using Anti-SAE1 antibody NBP2-13273 (A) shows similar pattern to independent antibody NBP2-13272 (B).](http://images.novusbio.com/fullsize/SUMO-Activating-Enzyme-E1-SAE1-Antibody-Western-Blot-NBP2-13273-img0010.jpg "Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Analysis using Anti-SAE1 antibody NBP2-13273 (A) shows similar pattern to independent antibody NBP2-13272 (B).")
![Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/SUMO-Activating-Enzyme-E1-SAE1-Antibody-Western-Blot-NBP2-13273-img0005.jpg "Western Blot: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/SUMO-Activating-Enzyme-E1-SAE1-Antibody-Immunohistochemistry-Paraffin-NBP2-13273-img0006.jpg "Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/SUMO-Activating-Enzyme-E1-SAE1-Antibody-Immunohistochemistry-Paraffin-NBP2-13273-img0007.jpg "Immunohistochemistry-Paraffin: SUMO Activating Enzyme E1 (SAE1) Antibody [NBP2-13273] - Staining of human testis shows high expression.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")