Tight Junction Protein 2 Antibody - BSA Free

Western Blot: Tight Junction Protein 2 Antibody [NBP2-68905] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP2-68905] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tight Junction Protein 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TJP2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Tight Junction Protein 2 Recombinant Protein Antigen (NBP2-68905PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Tight Junction Protein 2 Antibody - BSA Free

• C9DUPq21.11
• DFNA51
• DUP9q21.11
• MGC26306
• tight junction protein 2 (zona occludens 2)
• Tight junction protein 2
• TJP2
• X104
• X104tight junction protein ZO-2
• ZO2
• ZO-2
• ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2)
• Zona occludens protein 2
• Zonula occludens protein 2

Background

TJP2 - tight junction protein 2 (zona occludens 2). embers of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-2, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-2 can interact with zona occludens 1 (ZO-1). Furthermore, the PDZ2 domain of ZO-2 was shown to interact with connexin-43, the predominant connexin in epithelial and most other tissues which is involved in cell growth control and embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TJP2