TRAP alpha Antibody - BSA Free

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-SSR1 antibody NBP1-86912 (A) shows similar protein distribution across tissues to independent antibody NBP1-87815 (B).

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-SSR1 antibody NBP1-86912 (A) shows similar protein distribution across tissues to independent antibody NBP1-87815 (B).

Western Blot: TRAP alpha Antibody [NBP1-86912] - Analysis using Anti-SSR1 antibody NBP1-86912 (A) shows similar pattern to independent antibody NBP1-87815 (B).

Immunocytochemistry/Immunofluorescence: TRAP alpha Antibody [NBP1-86912] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Western Blot: TRAP alpha Antibody [NBP1-86912] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Staining of human cerebral cortex, liver).

• Reactivity: Hu, Mu, Rt, Ce
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAP alpha Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRAP alpha Protein (NBP1-86912PEP)

  Loading...

Reactivity Notes

C. elegans reactivity reported in scientific literature (PMID: 31840061).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRAP alpha Antibody - BSA Free

• DKFZp781N23103
• FLJ14232
• FLJ22100
• FLJ23034
• FLJ78242
• FLJ93042
• signal sequence receptor, alpha
• SSR alpha subunit
• SSR-alpha
• translocon-associated protein alpha subunit
• translocon-associated protein subunit alpha
• TRAP alpha
• TRAP-alpha
• TRAPASignal sequence receptor subunit alpha

Background

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRAP alpha Antibody (NBP1-86912)(4)

Publications using NBP1-86912

• Tarab-Ravski D, Hazan-Halevy I, Goldsmith M et al. Delivery of Therapeutic RNA to the Bone Marrow in Multiple Myeloma Using CD38-Targeted Lipid Nanoparticles Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2023-05-12 [PMID: 37171801] (Immunohistochemistry, Mouse)
• Li S, Lin Q, Shao X, et al. Requirement for translocon-associated protein (TRAP) alpha in insulin biogenesis Sci Adv 2019-12-01 [PMID: 31840061] (ICC/IF, C. elegans)
• Taylor MS, Ruch TR, Hsiao PY et al. Architectural Organization of the Metabolic Regulatory Enzyme Ghrelin O-Acyltransferase. J Biol Chem 2013-11-08 [PMID: 24045953] (ICC/IF, Human)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: SSR1