![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Analysis in human skin and liver tissues. Corresponding TROP-2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0009.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Analysis in human skin and liver tissues. Corresponding TROP-2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Flow, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGEVDIGDAAYYFERDIKGESL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TACSTD2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Panagiotis Fotakis |
Flow | Human | 02/15/2024 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for TROP-2 Antibody (NBP2-49166)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TACSTD2 |
![Western Blot: TROP-2 Antibody [NBP2-49166] - Analysis in human cell lines A-431 and HEK293 using Anti-TACSTD2 antibody. Corresponding TACSTD2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/antibody/nbp2-49166_rabbit-polyclonal-trop-2-antibody-western-blot-910202383712..jpg "Western Blot: TROP-2 Antibody [NBP2-49166] - Analysis in human cell lines A-431 and HEK293 using Anti-TACSTD2 antibody. Corresponding TACSTD2 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
![Immunocytochemistry/Immunofluorescence: TROP-2 Antibody [NBP2-49166] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & plasma membrane.](http://images.novusbio.com/fullsize/TROP-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49166-img0004.jpg "Immunocytochemistry/Immunofluorescence: TROP-2 Antibody [NBP2-49166] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & plasma membrane.")
![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0013.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human kidney shows moderate membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0010.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human kidney shows moderate membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human liver shows no positivity in hepatocytes, as expected.](http://images.novusbio.com/fullsize/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0011.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human liver shows no positivity in hepatocytes, as expected.")
![Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/TROP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49166-img0012.jpg "Immunohistochemistry-Paraffin: TROP-2 Antibody [NBP2-49166] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Flow Cytometry: Rabbit Polyclonal TROP-2 Antibody [NBP2-49166] - Detection of TROP-2 on CHOK1 cells expressing human TROP-2. Cells received 5 uL of the human TROP-2 antibody (BLUE) or isotype control (RED) for 30 minutes followed by secondary donkey a-rabbit APC antibody. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp2-49166_rabbit-polyclonal-trop-2-antibody-flow-cytometry-192202485532..png "Flow Cytometry: Rabbit Polyclonal TROP-2 Antibody [NBP2-49166] - Detection of TROP-2 on CHOK1 cells expressing human TROP-2. Cells received 5 uL of the human TROP-2 antibody (BLUE) or isotype control (RED) for 30 minutes followed by secondary donkey a-rabbit APC antibody. Image from a verified customer review.")
![Flow Cytometry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Flow_Cytometry_15685.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23512.jpg)
![Immunohistochemistry EpCAM/TROP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EpCAM_AF960_Immunohistochemistry_23513.jpg)
![Western Blot TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Western_Blot_12086.jpg)
![Immunohistochemistry TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Immunohistochemistry_7209.jpg)
![Flow Cytometry TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Flow_Cytometry_9384.jpg)
![Flow Cytometry CD83 Antibody (HB15e) [Unconjugated]](https://images.novusbio.com/images2/CD83_MAB1774_Flow_Cytometry_16153.jpg)
![Immunocytochemistry CD83 Antibody (HB15e) [Unconjugated]](https://images.novusbio.com/images2/CD83_MAB1774_Immunocytochemistry__Immunofluorescence_21639.jpg)
![Immunocytochemistry CD83 Antibody (HB15e) [Unconjugated]](https://images.novusbio.com/images2/CD83_MAB1774_Immunocytochemistry_6572.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
