Ubiquitin Antibody (83406) [Unconjugated]

Western blot shows lysates of HCT-116 human colorectal carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Ubiquitin Monoclonal Antibody (Catalog # A-104) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for Ubiquitin at approximately 5-10 & 37-250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Western blot shows lysates of HCT-116 human colorectal carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Ubiquitin Monoclonal Antibody (Catalog # A-104) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for Ubiquitin at approximately 5-10 & 37-250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Product Discontinued

Ubiquitin Antibody (83406) [Unconjugated] Summary

• Additional Information: Product is in the process of being discontinued.
• Immunogen: Human Ubiquitin+1 synthetic peptide
  SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
• Specificity: This antibody detects human Ubiquitin and Ubiquitin+1 in Western blots.
• Source: N/A
• Isotype: IgG2b
• Clonality: Monoclonal
• Host: Mouse
• Gene: UBB
• Purity Statement: Protein A or G purified from hybridoma culture supernatant

Applications/Dilutions

• Dilutions:
  • Western Blot 0.1-0.5 ug/mL

Packaging, Storage & Formulations

• Storage: Store the unopened product at -20 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Storage below -20 °C is not recommended. Do not use past expiration date.
• Buffer: Supplied as a solution in PBS containing Glycerol and Sodium Azide.
• Preservative: Sodium Azide

Notes

* Contains <0.1% Sodium Azide, which is not hazardous at this concentration according to GHS classifications. Refer to SDS for additional information and handling instructions.

This product is produced by and ships from R&D Systems, Inc., a Bio-Techne brand.

Alternate Names for Ubiquitin Antibody (83406) [Unconjugated]

• RPS27A
• UBA52
• UBB ubiquitin B
• UBB
• UBC
• Ubiquitin

Background

Ubiquitin is a 76 amino acid (aa) protein that is ubiquitously expressed in all eukaryotic organisms. Ubiquitin is highly conserved with 96% aa sequence identity shared between human and yeast. In mammals, four ubiquitin genes encode for two ubiquitin­ribosomal fusion proteins and two polyubiquitin proteins. Cleavage of the ubiquitin precursors by deubiquitinating enzymes gives rise to identical ubiquitin monomers each with a predicted molecular weight of 8.6 kDa. Conjugation of ubiquitin to target proteins involves the formation of an isopeptide bond between the C­terminal glycine residue of ubiquitin and a lysine residue in the target protein. This process of conjugation, referred to as ubiquitination or ubiquitylation, is a multi­step process that requires three enzymes: a ubiquitin­activating (E1) enzyme, a ubiquitin­conjugating (E2) enzyme, and a ubiquitin ligase (E3). Ubiquitination is classically recognized as a mechanism to target proteins for degradation and as a result, ubiquitin was originally named ATP­dependent Proteolysis Factor 1 (APF­1). In addition to protein degradation, ubiquitination has been shown to mediate a variety of biological processes such as signal transduction, endocytosis, and post­endocytic sorting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ubiquitin Antibody (A-104)(4)

Publications using A-104

• Ardah, MT;Radwan, N;Khan, E;Kitada, T;Haque, ME; Parkin Precipitates on Mitochondria via Aggregation and Autoubiquitination International journal of molecular sciences 2023-05-19 [PMID: 37240373] (Bioassay, N/A)
• L Mañas-Garc, C Denhard, J Mateu, X Duran, J Gea, E Barreiro Beneficial Effects of Resveratrol in Mouse Gastrocnemius: A Hint to Muscle Phenotype and Proteolysis Cells, 2021-09-15;10(9):. 2021-09-15 [PMID: 34572085] (Western Blot, Mouse)
• M Fottner, AD Brunner, V Bittl, D Horn-Ghetk, A Jussupow, VRI Kaila, A Bremm, K Lang Site-specific ubiquitylation and SUMOylation using genetic-code expansion and sortase Nat. Chem. Biol., 2019-02-15;15(3):276-284. 2019-02-15 [PMID: 30770915] (Western Blot, Human)
• Nora Y Hakami Trichostatin A, a histone deacetylase inhibitor suppresses NADPH Oxidase 4-Derived Redox Signalling and Angiogenesis J Cell Mol Med, 2016-06-14;0(0):. 2016-06-14 [PMID: 27297729] (Immunoprecipitation, Human)

Bioinformatics

• Gene Symbol: UBB