UTP6 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
UTP6 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for UTP6 Antibody - BSA Free
Background
UTP6 is involved in nucleolar processing of pre-18S ribosomal RNA
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ICC, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ELISA, IB, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Pm, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for UTP6 Antibody (NBP1-88468) (0)
There are no publications for UTP6 Antibody (NBP1-88468).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UTP6 Antibody (NBP1-88468) (0)
There are no reviews for UTP6 Antibody (NBP1-88468).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UTP6 Antibody (NBP1-88468) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UTP6 Products
Blogs on UTP6
![Western Blot: UTP6 Antibody [NBP1-88468] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-UTP6 antibody. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/UTP6-Antibody-Western-Blot-NBP1-88468-img0013.jpg "Western Blot: UTP6 Antibody [NBP1-88468] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-UTP6 antibody. Remaining relative intensity is presented.")
![Immunocytochemistry/Immunofluorescence: UTP6 Antibody [NBP1-88468] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88468-img0008.jpg "Immunocytochemistry/Immunofluorescence: UTP6 Antibody [NBP1-88468] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human tonsil shows strong positivity in nucleoli in lymphoid cells.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0012.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human tonsil shows strong positivity in nucleoli in lymphoid cells.")
![Western Blot: UTP6 Antibody [NBP1-88468] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/UTP6-Antibody-Western-Blot-NBP1-88468-img0006.jpg "Western Blot: UTP6 Antibody [NBP1-88468] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human liver shows strong to strong positivity in nucleoli in hepatocytes.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0009.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human liver shows strong to strong positivity in nucleoli in hepatocytes.")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human skin shows strong positivity in nucleoli in epidermal cells.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0010.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human skin shows strong positivity in nucleoli in epidermal cells.")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human testis shows strong positivity in nucleoli.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0011.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human testis shows strong positivity in nucleoli.")
![Immunoprecipitation SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunoprecipitation_15440.jpg)
![Western Blot SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Western_Blot_12094.jpg)
![Immunocytochemistry SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunocytochemistry__Immunofluorescence_20494.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")