ZBTB7A/Pokemon Antibody (3T2J1)

Western Blot: ZBTB7A/Pokemon Antibody (3T2J1) [NBP3-15914] - Western blot analysis of extracts of various cell lines, using ZBTB7A/Pokemon Rabbit mAb (NBP3-15914) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: ZBTB7A/Pokemon Antibody (3T2J1) [NBP3-15914] - Immunohistochemistry of paraffin-embedded human colon carcinoma using ZBTB7A/Pokemon Rabbit mAb (NBP3-15914) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: ZBTB7A/Pokemon Antibody (3T2J1) [ZBTB7A/Pokemon] - Confocal imaging of MCF7 cells using ZBTB7A/Pokemon Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: ZBTB7A/Pokemon Antibody (3T2J1) [ZBTB7A/Pokemon] - Confocal imaging of U-2 OS cells using ZBTB7A/Pokemon Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: ZBTB7A/Pokemon Antibody (3T2J1) [ZBTB7A/Pokemon] - Confocal imaging of HeLa cells using ZBTB7A/Pokemon Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clone: 3T2J1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZBTB7A/Pokemon Antibody (3T2J1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ZBTB7A/Pokemon (O95365). NYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ZBTB7A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:3000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZBTB7A/Pokemon Antibody (3T2J1)

• DKFZp547O146
• Factor binding IST protein 1
• Factor that binds to inducer of short transcripts protein 1
• FBI-1
• FBI-1POK erythroid myeloid ontogenic factor
• FBI1TTF-I-interacting peptide 21
• HIV-1 inducer of short transcripts binding protein
• Leukemia/lymphoma-related factor
• LRF
• LRFHIV-1 1st-binding protein 1
• lymphoma related factor
• MGC99631
• Pokemon
• TIP21
• ZBTB7A
• ZBTB7zinc finger and BTB domain containing 7
• zinc finger and BTB domain containing 7A
• zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcriptsbinding protein
• zinc finger and BTB domain-containing protein 7A
• Zinc finger protein 857A
• ZNF857APOZ and Krueppel erythroid myeloid ontogenic factor

Background

Pokemon (POK Erythroid Myeloid Ontogenic factor) is part of the POK gene family that encodes proteins. It is an oncogene, but its role is unique in that it controls the activity of other oncogenes. POK proteins are critical in embryonic development, cellular differentiation, and oncogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB7A