Anillin Antibody - BSA Free

Western Blot: Anillin Antibody [NBP2-38630] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ANLN antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Anillin Antibody [NBP2-38630] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Anillin Antibody [NBP2-38630] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Anillin Antibody [NBP2-38630] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Anillin Antibody [NBP2-38630] - Analysis in human testis and skeletal muscle tissues. Corresponding ANLN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Anillin Antibody [NBP2-38630] - Staining of human colon shows moderate to strong nuclear positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: Anillin Antibody [NBP2-38630] - Staining of human placenta shows moderate to strong nuclear positivity in a subset of trophoblastic cells.

Immunohistochemistry-Paraffin: Anillin Antibody [NBP2-38630] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Anillin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DLFSDVLEEGELDMEKSQEEMDQALAESSEEQEDALNISSMSLLAPLAQTVGVVSPESLVSTPRLELKDTSRSDESPKPGKFQRTRVPRAESGDSLGSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANLN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Anillin Protein (NBP2-38630PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Anillin Antibody - BSA Free

• actin-binding protein anillin
• anillin (Drosophila Scraps homolog), actin binding protein
• ANILLIN
• anillin, actin binding protein (scraps homolog, Drosophila)
• anillin, actin binding protein
• DKFZp779A055
• Drosophila Scraps homolog
• scra
• Scraps

Background

Anillin is a 124 kDa scaffolding protein that plays an important role in cell division. Anillin interacts with septins and mediates septin filament assembly and stabilization in the construction of the contractile ring responsible for cleavage furrow formation and cytokinesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANLN
• Uniprot:
  • Q9NQW6(Human)