Claudin-18 Antibody - BSA Free

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - analysis in human stomach and liver tissues. Corresponding CLDN18 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human stomach shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human tonsil shows weak to moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human stomach cancer shows moderate to strong membranous positivity in tumor cells.

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human lung shows moderate membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human pancreatic cancer shows moderate membranous positivity in tumor cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Claudin-18 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLDN18
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Claudin-18 Recombinant Protein Antigen (NBP2-32002PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Claudin-18 Antibody - BSA Free

• claudin 18
• Claudin18
• Claudin-18
• CLDN18
• SFTA5
• SFTPJ
• surfactant associated 5
• surfactant associated protein J
• surfactant, pulmonary associated protein J

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Claudin-18 Antibody (NBP2-32002)(1)

Publication using NBP2-32002

• Jasani B, Schildhaus H, Dodson A et al. 7P Global ring study determining reproducibility & comparability of CLDN18 testing assays in gastric cancer ESMO Open 2023-02-01

Bioinformatics

• Gene Symbol: CLDN18
• Uniprot:
  • P56856(Human)