GADD45G Antibody - BSA Free

Western Blot: GADD45G Antibody [NBP1-84385] - Analysis in control (vector only transfected HEK293T lysate) and GADD45G over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Staining of human cell line SH-SY5Y shows localization to nucleus.

Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Staining of human skin shows very weak cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GADD45G Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVG
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GADD45G
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GADD45G Protein (NBP1-84385PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GADD45G Antibody - BSA Free

• CR6DNA damage-inducible transcript 2 protein
• Cytokine-responsive protein CR6
• DDIT-2
• DDIT2GADD45-gamma
• growth arrest and DNA damage-inducible protein GADD45 gamma
• growth arrest and DNA-damage-inducible, gamma
• GRP1717 kD

Background

GADD45G is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GADD45G Antibody (NBP1-84385)(1)

Publication using NBP1-84385

• Zhang L, Li Q, Wang H et al. Gadd45g, a novel antidepressant target, mediates metformin-induced neuronal differentiation of neural stem cells via DNA demethylation Stem Cells 2022-05-05 [PMID: 35511865]

Bioinformatics

• Gene Symbol: GADD45G