hnRNP A1 Antibody - BSA Free

Western Blot: hnRNP A1 Antibody [NBP2-14096] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP2-14096] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP2-14096] - Staining of human fallopian tube shows strong nuclear positivity.

Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP2-14096] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP2-14096] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP2-14096] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

hnRNP A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATNARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRDYFEQHGKMEVIEIMTEAVARKGALPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  hnRNP A1 Protein (NBP2-14096PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for hnRNP A1 Antibody - BSA Free

• Helix-destabilizing protein
• heterogeneous nuclear ribonucleoprotein A1
• heterogeneous nuclear ribonucleoprotein A1B protein
• heterogeneous nuclear ribonucleoprotein B2 protein
• heterogeneous nuclear ribonucleoprotein core protein A1
• hnRNP A1
• hnRNP core protein A1
• hnRNPA1
• hnRNP-A1
• HNRPA1MGC102835
• nuclear ribonucleoprotein particle A1 protein
• single-strand DNA-binding protein UP1
• Single-strand RNA-binding protein

Background

RNA polymerase II transcripts in the nucleus are in complex with several proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are important in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA translation and turnover. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts.1, 3, 4 Isolated hnRNPs consist of protein groups named A to U and many of these protein groups consist of more than one isoform. The major steady-state proteins of the isolated hnRNP complex are A1, A2, B1, B2, C1, and C2, with a range of molecular weight starting with 34 kDa up to 43 kDa.1, 3, 4 hnRNP-A1 is important in pre-mRNA processing and in mRNA export from the nucleus. The protein binds to its RNA target through a consensus RNA-binding site UAGGGU. The protein contains a 38-amino acid domain called M9, which is important for the interaction with the transportin protein, and therefore, for its import and export from the nucleus. RanGTP mediates dissociation of hnRNP-A1 from transportin. hnRNP-A1 is ubiquitously expressed with a higher expression in proliferating and/or transformed cells than in differentiated tissues.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPA1