Neurotensin Antibody - Azide and BSA Free

Western Blot: Neurotensin Antibody [H00004922-D01P] - Analysis of NTS expression in transfected 293T cell line by NTS polyclonal antibody.Lane 1: NTS transfected lysate(19.80 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Neurotensin Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NTS (NP_006174.1, 1 a.a. - 170 a.a.) full-length human protein. MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NTS
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Neurotensin Antibody - Azide and BSA Free

• Neurotensin
• neurotensin/neuromedin N
• NMN-125
• NN
• NT
• NT/N
• NTS
• NTS1

Background

This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. It may be involved in dopamine-associated pathophysiological events, in the maintenance of gut structure and function, and in the regulation of fat metabolism. Tissue-specific processing may lead to the formation in some tissues of larger forms of neuromedin N and neurotensin. The large forms may represent more stable peptides that are also biologically active.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Neurotensin Antibody (H00004922-D01P). (Showing 1 - 1 of 1 FAQ).

1. Can you please send me the amino acid sequences of the immunogens used for generating your 7 different Neurotensin antibodies (H00004922-M03, H00004922-M01, H00004922-B01, H0000-B01P, H00004922-D01P, NBP1-50153, and NBP178333).
   • The immunogen of H00004922-M01 and H00004922-M03 is amino acids 71-171 of the NTS protein (accession number is AAH10918). As for H00004922-B01, H00004922-B01P and H00004922-D01P, their immunogen is full-length human NTS protein (accession number NP_006174.1) To our knowledge these antibodies have not been epitope mapped.

Bioinformatics

• Gene Symbol: NTS
• Uniprot:
  • NP_006174.1(Human)