PEPT2/SLC15A2 Antibody - BSA Free

Western Blot: PEPT2/SLC15A2 Antibody [NBP1-59626] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PEPT2/SLC15A2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC15A2(solute carrier family 15 (H+/peptide transporter), member 2) The peptide sequence was selected from the middle region of SLC15A2. Peptide sequence GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC15A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PEPT2/SLC15A2 Antibody - BSA Free

• Kidney H(+)/peptide cotransporter
• kidney isoform
• PEPT2
• PEPT2FLJ33407
• Peptide transporter 2
• SLC15A2
• solute carrier family 15 (H+/peptide transporter), member 2
• solute carrier family 15 member 2

Background

SLC15A2 belongs to the PTR2/POT transporter (TC 2.A.17) family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PEPT2/SLC15A2 Antibody (NBP1-59626)(1)

Publication using NBP1-59626

• Takano M, Kuriyama S, Kameda N et al. Effect of Corticosteroids on Peptide Transporter 2 Function and Induction of Innate Immune Response by Bacterial Peptides in Alveolar Epithelial Cells Biological & pharmaceutical bulletin 2022-02-03 [PMID: 35110509] (WB)

Bioinformatics

• Gene Symbol: SLC15A2
• Uniprot:
  • Q16348(Human)