PMEL17/SILV Antibody - BSA Free

Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms9755) licensed under a CC-BY license.

Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.

Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - Human kidney

• Reactivity: Hu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

PMEL17/SILV Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SILV(silver homolog (mouse)) The peptide sequence was selected from the N terminal of human PMEL (NP_008859). Peptide sequence HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Melanosome Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PMEL
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1.25 ug/ml
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26511633).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for PMEL17/SILV Antibody - BSA Free

• D12S53EP1
• Gp100
• ME20
• ME20M
• ME20-M
• melanocyte protein mel 17
• Melanocyte protein Pmel 17
• Melanocytes lineage-specific antigen GP100
• Melanoma-associated ME20 antigen
• melanosomal matrix protein17
• PMEL
• PMEL17
• PMEL17P100
• premelanosome proteinME20M
• SI
• SIL
• SILV
• silver (mouse homolog) like
• silver homolog (mouse)
• Silver locus protein homolog
• silver, mouse, homolog of
• SILVPmel17

Background

SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PMEL17/SILV Antibody (NBP1-69571)(8)

Publications using NBP1-69571

• Ruotsalainen J, Lopez-Ramos D, Rogava M et al. The myeloid cell type I IFN system promotes antitumor immunity over pro-tumoral inflammation in cancer T-cell therapy Clinical & translational immunology 2021-04-29 [PMID: 33968406] (WB, IHC-P, Mouse)
• Forsthuber A, Lipp K, Andersen L et al. CXCL5 as Regulator of Neutrophil Function in Cutaneous Melanoma J. Invest. Dermatol. 2019-01-01 [PMID: 30009831] (IF/IHC, Mouse)
• Riesenberg S, Groetchen A, Siddaway R et al. MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment. Nat Commun 2015-11-04 [PMID: 26530832] (IHC-P, Mouse)
• Holzel M, Landsberg J, Glodde N et al. A preclinical model of malignant peripheral nerve sheath tumor-like melanoma is characterized by infiltrating mast cells. Cancer Res. 2015-10-28 [PMID: 26511633] (IHC-P, Mouse, Human)
• Bald T, Quast T, Landsberg J et al. Ultraviolet-radiation-induced inflammation promotes angiotropism and metastasis in melanoma. Nature 2014-03-06 [PMID: 24572365] (IHC-P, Mouse)
• Glodde N, Kraut A, van den Boorn-Konijnenberg D Experimental and stochastic models of melanoma T-cell therapy define impact of subclone fitness on selection of antigen loss variants bioRxiv (IF/IHC, Mouse)
• Braun AD, Mengoni M, Bonifatius S et al. Activated Hgf-Met signaling cooperates with oncogenic Braf to drive primary cutaneous melanomas and angiotropic lung metastases in mice J. Invest. Dermatol. 2020-01-20 [PMID: 31972251] (WB)
• Theos AC, Truschel ST, Tenza D et al. A lumenal domain-dependent pathway for sorting to intralumenal vesicles of multivesicular endosomes involved in organelle morphogenesis. Dev Cell. 2006-01-01 [PMID: 16516837]

Bioinformatics

• Gene Symbol: PMEL
• Entrez:
  • 6490(Human)
• Uniprot:
  • P40967(Human)