Proteasome 20S alpha 3 Antibody - BSA Free

Western Blot: Proteasome 20S alpha 3 Antibody [NBP2-94032] - Analysis of extracts of various cell lines, using PSMA3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry-Paraffin: Proteasome 20S alpha 3 Antibody [NBP2-94032] - Rat brain using PSMA3 Rabbit pAb at dilution of 1:100 (40x lens).

Western Blot: Proteasome 20S alpha 3 Antibody [NBP2-94032] - Analysis of 200ug extracts of HL-60 cells, using Proteasome 20S alpha 3 at a dilition of 1:1000.

Immunohistochemistry-Paraffin: Proteasome 20S alpha 3 Antibody [NBP2-94032] - Human colon carcinoma using PSMA3 Rabbit pAb at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: Proteasome 20S alpha 3 Antibody [NBP2-94032] - Mouse heart using PSMA3 Rabbit pAb at dilution of 1:100 (40x lens).

Immunocytochemistry/ Immunofluorescence: Proteasome 20S alpha 3 Antibody - Azide and BSA Free [Proteasome 20S alpha 3] - Immunofluorescence analysis of Mouse kidney tissue using Proteasome 20S alpha 3 Rabbit pAb at a dilution of 1:400 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Proteasome 20S alpha 3 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human PSMA3 (NP_002779.1). MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:50 - 1:100
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Proteasome 20S alpha 3 Antibody - BSA Free

• EC 3.4.25.1
• HC8
• HC8MGC32631
• Macropain subunit C8
• MGC12306
• Multicatalytic endopeptidase complex subunit C8
• proteasome (prosome, macropain) subunit, alpha type, 3
• Proteasome 20S alpha 3
• Proteasome component C8
• proteasome subunit alpha type-3
• proteasome subunit C8
• PSC3
• PSC8
• PSMA3

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PSMA3